Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0F5CJQ7

dbSWEET id: dbswt_1032

Accession:   A0A0F5CJQ7

Uniprot status:   Unreviewed

Organism:   Pristionchus pacificus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Diplogasterida ⇒ Neodiplogasteridae ⇒ Pristionchus.

Sequence Information back to top


Sequence length:   222

Substrate Binding Site:   INWN           CVV:   456       CHI:   -0.7

Selectivity Filter:   FTSL           CVV:   425       CHI:   5.1

Fasta sequence:

>tr|A0A0F5CJQ7|A0A0F5CJQ7_PRIPA|Unreviewed|Pristionchus_pacificus|222
MDVFSIFAAWLAIFSISFTFLPILQILDWKARGTADGFSSVNFVLPVLTIACWLRHGYMT
DDVNNKLINSVNLAAFTVYIFCFAYFQPVRKYLYIQLLSLFAVLYATFAYVDSVDSSLAA
DTMGGIAAAMQIVSLAGGIYDIKRAISMGTTEYIPASMQFGIFFLTGQWALFGYLAPNPY
IMVANLAGLAVNIVTIALYFIYPPITWRVPLIGTQQEHKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: A0A0F5CJQ7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0F5CJQ7_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.0% allowed    2.2% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0F5CJQ7_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.5% allowed    1.1% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0F5CJQ7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.6% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur