Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0F4HAR7
dbSWEET id: dbswt_2024
Accession: A0A0F4HAR7
Uniprot status: Unreviewed
Organism: Lactobacillus fermentum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 102
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0F4HAR7|A0A0F4HAR7_LACFE|Unreviewed|Lactobacillus fermentum| 102
MERIFIMQQPKEHSFDSEKFISWLGRFASVIAILMYVSYIAQIINNLHGQYGAPLQPFVA
GVNCSLWSIYAYFKKDRDWPVFWANFPGVFFSFATFITCFHF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 25 Model end: 101 Inward Open: Template: 4X5M.pdb Model structure: A0A0F4HAR7_inward.pdb Alignment file: A0A0F4HAR7_inw.pir Procheck score ⇒ Ramachandran plot: 88.6% favored 8.3% allowed 2.3% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0F4HAR7_outward.pdb Alignment file: A0A0F4HAR7_out.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed 2.3% week .0% disallowed Occluded: Model structure: A0A0F4HAR7_occluded.pdb Alignment file: A0A0F4HAR7_occ.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 9.1% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA