Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0F3RFS9

dbSWEET id: dbswt_2023

Accession:   A0A0F3RFS9

Uniprot status:   Unreviewed

Organism:   Rickettsia argasii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Rickettsiaceae ⇒ Rickettsieae ⇒ Rickettsia ⇒ spotted fever group.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   VAVA           CVV:   344       CHI:   12

Fasta sequence:

>tr|A0A0F3RFS9|A0A0F3RFS9_9RICK|Unreviewed|Rickettsia argasii|88
MSPKFMTFYEKYMMIVGTIGNFMFYVQAHKIFTCQSSASVSMPAFTISAIALCSWLIYGI
LIKNTPIIIANIVGVIGALLVLLTIIIY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0F3RFS9_inward.pdb    Alignment file: A0A0F3RFS9_inw.pir

Procheck score ⇒ Ramachandran plot: 90.0% favored    8.5% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0F3RFS9_outward.pdb    Alignment file: A0A0F3RFS9_out.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.9% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0F3RFS9_occluded.pdb    Alignment file: A0A0F3RFS9_occ.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    5.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur