Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0F2CH23
dbSWEET id: dbswt_1371
Accession: A0A0F2CH23
Uniprot status: Unreviewed
Organism: Streptococcus cristatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A0F2CH23|A0A0F2CH23_STRCR|Unreviewed|Streptococcus cristatus|87
MSKQKINRFVGSIGAFIGILVFVAYIPQIIANLQGSKAQPFQPLFAAVSCLIWVIYGWTK
EPKKDWILIIPNAAGVILGGLTFLTSL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87
Inward Open:
Template: 4X5M.pdb
Model structure: A0A0F2CH23_inward.pdb Alignment file: A0A0F2CH23_inw.pir
Procheck score ⇒ Ramachandran plot: 88.7% favored 8.1% allowed 2.4% week .8% disallowed
Outward Open:
Template: 4X5N.pdb
Model structure: A0A0F2CH23_outward.pdb Alignment file: A0A0F2CH23_out.pir
Procheck score ⇒ Ramachandran plot: 87.1% favored 12.1% allowed .0% week .8% disallowed
Occluded:
Model structure: A0A0F2CH23_occluded.pdb Alignment file: A0A0F2CH23_occ.pir
Procheck score ⇒ Ramachandran plot: 87.9% favored 9.7% allowed .8% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA