Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0F2CH23

dbSWEET id: dbswt_1371

Accession:   A0A0F2CH23

Uniprot status:   Unreviewed

Organism:   Streptococcus cristatus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CPCP           CVV:   352       CHI:   1.8

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A0F2CH23|A0A0F2CH23_STRCR|Unreviewed|Streptococcus cristatus|87
MSKQKINRFVGSIGAFIGILVFVAYIPQIIANLQGSKAQPFQPLFAAVSCLIWVIYGWTK
EPKKDWILIIPNAAGVILGGLTFLTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0F2CH23_inward.pdb    Alignment file: A0A0F2CH23_inw.pir

Procheck score ⇒ Ramachandran plot: 88.7% favored    8.1% allowed    2.4% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0F2CH23_outward.pdb    Alignment file: A0A0F2CH23_out.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    12.1% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0F2CH23_occluded.pdb    Alignment file: A0A0F2CH23_occ.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    9.7% allowed    .8% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur