Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0E9ZV13
dbSWEET id: dbswt_1369
Accession: A0A0E9ZV13
Uniprot status: Unreviewed
Organism: Vitellibacter vladivostokensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Vitellibacter.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: AGAG CVV: 230 CHI: 2.8
Fasta sequence:
>tr|A0A0E9ZV13|A0A0E9ZV13_9FLAO|Unreviewed|Vitellibacter vladivostokensis|88
MEIEQILGYAAGTLTTLAVLPQIIKSWKTKKVMDVSPLMFSILILGVGLWTVYGFVKMDL
PIIIFNGISFLLNGSMLILMLFYQADDK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0E9ZV13_inward.pdb Alignment file: A0A0E9ZV13_inw.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 4.6% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0E9ZV13_outward.pdb Alignment file: A0A0E9ZV13_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 6.2% allowed .0% week .8% disallowed Occluded: Model structure: A0A0E9ZV13_occluded.pdb Alignment file: A0A0E9ZV13_occ.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 5.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA