Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E9ZV13

dbSWEET id: dbswt_1369

Accession:   A0A0E9ZV13

Uniprot status:   Unreviewed

Organism:   Vitellibacter vladivostokensis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Vitellibacter.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A0A0E9ZV13|A0A0E9ZV13_9FLAO|Unreviewed|Vitellibacter vladivostokensis|88
MEIEQILGYAAGTLTTLAVLPQIIKSWKTKKVMDVSPLMFSILILGVGLWTVYGFVKMDL
PIIIFNGISFLLNGSMLILMLFYQADDK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0E9ZV13_inward.pdb    Alignment file: A0A0E9ZV13_inw.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.6% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0E9ZV13_outward.pdb    Alignment file: A0A0E9ZV13_out.pir

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.2% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0E9ZV13_occluded.pdb    Alignment file: A0A0E9ZV13_occ.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    5.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur