Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0E9EL75
dbSWEET id: dbswt_1368
Accession: A0A0E9EL75
Uniprot status: Unreviewed
Organism: Chlamydia trachomatis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Chlamydiae ⇒ Chlamydiales ⇒ Chlamydiaceae ⇒ Chlamydia/Chlamydophila group ⇒ Chlamydia.
Sequence Information back to top
Sequence length: 81
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0E9EL75|A0A0E9EL75_CHLTH|Unreviewed|Chlamydia trachomatis|81
MKMIGWVATFMSVMMYVSYIPQIMDNLAGHKGNFIQPLVVAINCSLWVYYGLFKKERDLP
LATANAPGIVFGFITVLTAMF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A0E9EL75_inward.pdb Alignment file: A0A0E9EL75_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.2% allowed 1.5% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0E9EL75_outward.pdb Alignment file: A0A0E9EL75_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 5.4% allowed 1.5% week .0% disallowed Occluded: Model structure: A0A0E9EL75_occluded.pdb Alignment file: A0A0E9EL75_occ.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.2% allowed 1.5% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA