Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E9EDM1

dbSWEET id: dbswt_1367

Accession:   A0A0E9EDM1

Uniprot status:   Unreviewed

Organism:   Chlamydia trachomatis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Chlamydiae ⇒ Chlamydiales ⇒ Chlamydiaceae ⇒ Chlamydia/Chlamydophila group ⇒ Chlamydia.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0E9EDM1|A0A0E9EDM1_CHLTH|Unreviewed|Chlamydia trachomatis|90
MKKNKKVLHAIAVIASVMSVLMYVSYIPQIYGNLHGEKGNPTQPLVAMINCIFWTIHGLY
GDDGETRDKSIIFANVPGIIFGFFAFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0E9EDM1_inward.pdb    Alignment file: A0A0E9EDM1_inw.pir

Procheck score ⇒ Ramachandran plot: 88.5% favored    6.2% allowed    2.3% week    3.1% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0E9EDM1_outward.pdb    Alignment file: A0A0E9EDM1_out.pir

Procheck score ⇒ Ramachandran plot: 85.4% favored    9.2% allowed    3.1% week    2.3% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0E9EDM1_occluded.pdb    Alignment file: A0A0E9EDM1_occ.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.9% allowed    .0% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur