Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E2LRW9

dbSWEET id: dbswt_1364

Accession:   A0A0E2LRW9

Uniprot status:   Unreviewed

Organism:   Porphyromonas gingivalis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Porphyromonas.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0E2LRW9|A0A0E2LRW9_PORGN|Unreviewed|Porphyromonas gingivalis|86
MNQEKFLSVLGWIATATAMAMYVSYIPQIGSNLSGHKGDWLQPMVAGINCVLWVGYGFIR
KKKDWPIVIANFPGIVCGFLASFTAM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0E2LRW9_inward.pdb    Alignment file: A0A0E2LRW9_inw.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    11.3% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0E2LRW9_outward.pdb    Alignment file: A0A0E2LRW9_out.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    10.5% allowed    2.4% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0E2LRW9_occluded.pdb    Alignment file: A0A0E2LRW9_occ.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    8.9% allowed    .8% week    2.4% disallowed

Gene Informationback to top


Gene ID:   23638600

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur