Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0E2LRW9
dbSWEET id: dbswt_1364
Accession: A0A0E2LRW9
Uniprot status: Unreviewed
Organism: Porphyromonas gingivalis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Porphyromonas.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0E2LRW9|A0A0E2LRW9_PORGN|Unreviewed|Porphyromonas gingivalis|86
MNQEKFLSVLGWIATATAMAMYVSYIPQIGSNLSGHKGDWLQPMVAGINCVLWVGYGFIR
KKKDWPIVIANFPGIVCGFLASFTAM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A0E2LRW9_inward.pdb Alignment file: A0A0E2LRW9_inw.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 11.3% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0E2LRW9_outward.pdb Alignment file: A0A0E2LRW9_out.pir Procheck score ⇒ Ramachandran plot: 87.1% favored 10.5% allowed 2.4% week .0% disallowed Occluded: Model structure: A0A0E2LRW9_occluded.pdb Alignment file: A0A0E2LRW9_occ.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 8.9% allowed .8% week 2.4% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA