Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E0NFF2

dbSWEET id: dbswt_293

Accession:   A0A0E0NFF2

Uniprot status:   Unreviewed

Organism:   Oryza rufipogon

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   321

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   ASVS           CVV:   318       CHI:   4.4

Fasta sequence:

>tr|A0A0E0NFF2|A0A0E0NFF2_ORYRU|Unreviewed|Oryza_rufipogon|321
MAFMSMERSTWAFTFGILGINMLMNAAFISCIRPTFYRVYRKKSTEGFQSTPYVVTLFSC
MLWMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGV
IALVTLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLS
AVIWFLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKKPLVASSSSAVVAAGLEIKL
PEHVKEVQAVAKGAVAAAPEGRISCGAEVHPIDDVMPSEVVEVKVDDEETNRTDEMAGDG
DHAMVRTEQIIKPDMAIVVEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   219

Alignment file: A0A0E0NFF2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0E0NFF2_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.8% allowed    .0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0E0NFF2_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.2% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0E0NFF2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.2% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur