Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E0LXB9

dbSWEET id: dbswt_70

Accession:   A0A0E0LXB9

Uniprot status:   Unreviewed

Organism:   Oryza punctata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   309

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A0E0LXB9|A0A0E0LXB9_ORYPU|Unreviewed|Oryza_punctata|309
MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIILYLVYAPRRARLRTLAFFLLLDVAAFALI
VVTTLYFVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSA
VAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAA
AAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQTDGGVVVAAAADKEQQQNKP
EVIEITAAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   218

Alignment file: A0A0E0LXB9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0E0LXB9_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    3.7% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0E0LXB9_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.0% favored    5.3% allowed    1.6% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0E0LXB9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    6.4% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0006825 - copper ion transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur