| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0E0KZU2
dbSWEET id: dbswt_534
Accession: A0A0E0KZU2
Uniprot status: Unreviewed
Organism: Oryza punctata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 246
Substrate Binding Site: CSWN CVV: 418 CHI: -2.7
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|A0A0E0KZU2|A0A0E0KZU2_ORYPU|Unreviewed|Oryza_punctata|246
MFPDIRFIVGIIGSVACMLLYAAPILTFKRVIKKASIEEFSCIPYILALFSCLTYSWYGF
PVVSYGWENLTVCSISLLGVLFEGTFISIYVWFAPRGKKKQVMLMASLILAVFCMTVFFS
SFSIHNHHIRKVFVGSVGLVSSVSMYGSPLVAMKQVIRTKSVEFMPFYLSLFTLFTSLTW
MAYGVIGRDPFIATPNCIGSIMGILQLVVYCIYSKCKEAPKVLHDIEQVNVVKIPTSHVD
TKGHNP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A0E0KZU2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0E0KZU2_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.3% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0E0KZU2_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.8% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0E0KZU2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 6.9% allowed 1.6% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA