| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0E0JKY3
dbSWEET id: dbswt_962
Accession: A0A0E0JKY3
Uniprot status: Unreviewed
Organism: Oryza punctata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 252
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A0E0JKY3|A0A0E0JKY3_ORYPU|Unreviewed|Oryza_punctata|252
MISPDAARNVVGIIGNVISFGLFLSPVPTFWRICKKKDVEEFKADPYLATLLNCMLWVFY
GIPVVHPNSILVVTINGIGLVVEGAYLIIFFLYSPNKKRLRMMAVLGVELVFMVAVILGV
LLGAHTHEKRSMIVGILCVFFGSIMYFSPLTIMGKVIKTKSVEYMPFFLSLVCFLNGVCW
TAYALIRFDIYVTIPNGLGALFGAIQLILYACYYRTTPKKTKASKDVEMPSVVVSGPGAA
TAAAAASVTVER
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A0E0JKY3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0E0JKY3_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.4% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0E0JKY3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 5.4% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0E0JKY3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.4% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA