Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E0JHQ9

dbSWEET id: dbswt_484

Accession:   A0A0E0JHQ9

Uniprot status:   Unreviewed

Organism:   Oryza punctata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   256

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VNMN           CVV:   421       CHI:   -0.9

Fasta sequence:

>tr|A0A0E0JHQ9|A0A0E0JHQ9_ORYPU|Unreviewed|Oryza_punctata|256
MDYSTLFIIGIMGNIAAGLVFLSPIKTFCRIVRRGTTEGFGSAPYVFTLLNALLWFYYGV
TKPDGLLVATINGFGAVVELAYVALFIGYAADQATRLNTIKWAVVLDIGFTGLVFVVTRF
AISELNLRIMVIGIVCACFNIFMYGAPLAAVRTVITEGSVEFMPLFLSMSLLINGGIWVA
YAMLDRDIFLLIPNGIGFILGTIQLIVYYFHPSLIYYFNMIFVNRLVPRNGSEAAAGEPQ
EEAPLLAPNDRHGQDV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   213

Alignment file: A0A0E0JHQ9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0E0JHQ9_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.1% favored    7.1% allowed    1.1% week    2.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0E0JHQ9_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    4.4% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0E0JHQ9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    5.5% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur