| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0E0FC44
dbSWEET id: dbswt_336
Accession: A0A0E0FC44
Uniprot status: Unreviewed
Organism: Oryza meridionalis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 291
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: TSVS CVV: 344 CHI: 1.9
Fasta sequence:
>tr|A0A0E0FC44|A0A0E0FC44_9ORYZ|Unreviewed|Oryza_meridionalis|291
MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW
IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL
LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV
WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEELPVV
VNVGKLAAATPDRSSGAVHVHPVPRSCAAAAEPEVLVDIPPPPRAVEVAAV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: A0A0E0FC44.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0E0FC44_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 4.2% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0E0FC44_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 3.7% allowed 1.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0E0FC44_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA