Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0E0E0Z5
dbSWEET id: dbswt_68
Accession: A0A0E0E0Z5
Uniprot status: Unreviewed
Organism: Oryza meridionalis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 308
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0E0E0Z5|A0A0E0E0Z5_9ORYZ|Unreviewed|Oryza_meridionalis|308
MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRARLRTLAFFLLLDVAAFALI
VVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSA
VAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAA
AAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELQNKPE
VIEITAAV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: A0A0E0E0Z5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0E0E0Z5_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0E0E0Z5_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0E0E0Z5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 6.4% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0006825 - copper ion transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA