| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0E0DNC8
dbSWEET id: dbswt_533
Accession: A0A0E0DNC8
Uniprot status: Unreviewed
Organism: Oryza meridionalis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 245
Substrate Binding Site: CSWN CVV: 418 CHI: -2.7
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|A0A0E0DNC8|A0A0E0DNC8_9ORYZ|Unreviewed|Oryza_meridionalis|245
MFPDIRFIVGIIGSVACMLLYAAPILTFKRVIKKASVEEFSCIPHILALFSCLTYSWYGF
PVVSYGWENLTVCSISSLGVIFEGTFISIYVWFAPRGKKKQVMLMASLILAVFCMTVFFS
SFSIHNHHIRKVFVGSVGLVSSISMYGSPLVAMKQVIRTKSVEFMPFYLSLFTLFTSLTW
MAYGVIGRDPFIATPNCIGSIMGILQLVVYCIYSKRKEAPKVLHDIEQANVVKIPTSHVD
TKVDS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A0E0DNC8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0E0DNC8_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 5.3% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0E0DNC8_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.8% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0E0DNC8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.0% favored 5.8% allowed 2.1% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA