Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E0BJE6

dbSWEET id: dbswt_386

Accession:   A0A0E0BJE6

Uniprot status:   Unreviewed

Organism:   Oryza glumipatula

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   311

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   TSVS           CVV:   344       CHI:   1.9

Fasta sequence:

>tr|A0A0E0BJE6|A0A0E0BJE6_9ORYZ|Unreviewed|Oryza_glumipatula|311
MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW
IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL
LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV
WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATDDDHSAA
VKEHVVNIAKLSAVDVVVKTREVHPVDVESPPAEAQSVATGEAPPQQDDKAAAVAVSGAG
AGEKKEGQEQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   216

Alignment file: A0A0E0BJE6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0E0BJE6_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.8% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0E0BJE6_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0E0BJE6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.3% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur