Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0E0B528

dbSWEET id: dbswt_62

Accession:   A0A0E0B528

Uniprot status:   Unreviewed

Organism:   Oryza glumipatula

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   310

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A0E0B528|A0A0E0B528_9ORYZ|Unreviewed|Oryza_glumipatula|310
MDHLWASVFGILGNIVSFLVFLAPILCACRWGPKFQTNGWCRPTFLRVYRKKSTEGFSSV
PYVVALFSCTLWILYAMVKTNSSPLLTINAFGCVVEAAYIAVYLIYAPRPARLRALASFL
LLNVAAFSLVVVVTVAAVAQPHRVRVLGSICLAFSMAVFVAPMSVIMVVIKTKSAEFMPF
SLSFFLTLSAVAWFFYGLFTNDLYVTLPNVGGFFFGCVQMALYFKYRKPNTAAGGVMILP
TTAAAAAVDGAVAEPAAAAQQLAEELEMELAAAGAHAVAVLPASALPVLAELHKMEQEIG
TPRKGATKTV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   228

Alignment file: A0A0E0B528.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0E0B528_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    6.9% allowed    .5% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0E0B528_outward.pdb

Procheck score ⇒ Ramachandran plot: 87.2% favored    9.9% allowed    2.0% week    1.0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0E0B528_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.7% favored    8.4% allowed    2.0% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur