| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0D9VF45
dbSWEET id: dbswt_822
Accession: A0A0D9VF45
Uniprot status: Unreviewed
Organism: Leersia perrieri
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Leersia.
Sequence Information back to top
Sequence length: 336
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A0D9VF45|A0A0D9VF45_9ORYZ|Unreviewed|Leersia_perrieri|336
MGATTKEFRPGSDLTLYLRPLLLLTPSHNSTSDGILLLPVLVPVRLLHLQFRPAAARLSS
LLAPPRRTPDAGNERVFVVARAATMTISPDTIRTAIGVVGNGTALVLFLSPVPTFIRIWK
KGSVEQYSAVPYVATLLNCMMWVLYGLPAVHPHSMLVITINGTGMAIELTYIALFLAFSA
GAVRRRVLLLLAAEVAFVAAVAALVLSLAHTHDRRSMIVGILCVLFGTGMYAAPLSVMKM
VIQTKSVEYMPLFLSLASLVNGICWTAYALIRFDLYITIPNGLGVMFAIAQLILYAIYYK
STQQIMEARKRKADQAVAMTEVVVDSSAAAKNGGHY
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 86 Model end: 300
Alignment file: A0A0D9VF45.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0D9VF45_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.9% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0D9VF45_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0D9VF45_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.2% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA