Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0D9V4L8

dbSWEET id: dbswt_586

Accession:   A0A0D9V4L8

Uniprot status:   Unreviewed

Organism:   Leersia perrieri

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Leersia.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|A0A0D9V4L8|A0A0D9V4L8_9ORYZ|Unreviewed|Leersia_perrieri|230
MYSLYDIACFAAGLAGNVFALALFLSPVTTFKRILKAKSTEQFDGLPYLFSLLNCLICLW
YGLPWVADGRLLVATVNGTGVVFQLVYISLFIFYADSRKTRVKIIGLLMLVVFGFALISH
ASFAFFYQPLRQQFVGAVSMASLISMFASPLAVMGVVIRTESVEFMPFYLSLSTFLMSFS
FALYGLLLRDFFIYFPNGLGVILGAMQLALYAYYNRKWRGQGSSAPLLLA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   216

Alignment file: A0A0D9V4L8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0D9V4L8_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.8% favored    2.1% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0D9V4L8_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0D9V4L8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.3% allowed    2.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur