| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0D9V4L8
dbSWEET id: dbswt_586
Accession: A0A0D9V4L8
Uniprot status: Unreviewed
Organism: Leersia perrieri
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Leersia.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A0D9V4L8|A0A0D9V4L8_9ORYZ|Unreviewed|Leersia_perrieri|230
MYSLYDIACFAAGLAGNVFALALFLSPVTTFKRILKAKSTEQFDGLPYLFSLLNCLICLW
YGLPWVADGRLLVATVNGTGVVFQLVYISLFIFYADSRKTRVKIIGLLMLVVFGFALISH
ASFAFFYQPLRQQFVGAVSMASLISMFASPLAVMGVVIRTESVEFMPFYLSLSTFLMSFS
FALYGLLLRDFFIYFPNGLGVILGAMQLALYAYYNRKWRGQGSSAPLLLA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 216
Alignment file: A0A0D9V4L8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0D9V4L8_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.8% favored 2.1% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0D9V4L8_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 3.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0D9V4L8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.3% allowed 2.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA