| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0D9V2P8
dbSWEET id: dbswt_958
Accession: A0A0D9V2P8
Uniprot status: Unreviewed
Organism: Leersia perrieri
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Leersia.
Sequence Information back to top
Sequence length: 250
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A0D9V2P8|A0A0D9V2P8_9ORYZ|Unreviewed|Leersia_perrieri|250
MISPDAARNVVGIIGNVISFGLFLSPVPTFWRILKKKDVEEFKADPYLATLLNCMLWVFY
GLPIVHPNSILVVTINGIGLVVEAIYLIIFFLYSPNKKRLRMMAVLGVEAVFMVAVILGV
LLGAHTHKKRSMIVGILCVFFGSLMYFSPLTIMGKVVKTKSVEYMPFFLSLVSFLNGVCW
TAYALIRFDIYVTIPNGLGAFFGAIQLILYFCYYGSTPKESKQPPKDVEMPPHVVSGNTD
GGNVSITVER
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A0D9V2P8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0D9V2P8_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 6.5% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0D9V2P8_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.5% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0D9V2P8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 4.8% allowed 1.1% week 1.6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA