| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0D8L8Q3
dbSWEET id: dbswt_1363
Accession: A0A0D8L8Q3
Uniprot status: Unreviewed
Organism: Morganella morganii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Morganella.
Sequence Information back to top
Sequence length: 78
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0D8L8Q3|A0A0D8L8Q3_MORMO|Unreviewed|Morganella morganii|78
MRCLGWVATFTAFCMYVSYIPQIMDNLAGHKTSPLQPLAAAFNCTLWVIYGIKVKDLPVA
VANAPGVLFGLAAMLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 79 Inward Open: Template: 4X5M.pdb Model structure: A0A0D8L8Q3_inward.pdb Alignment file: A0A0D8L8Q3_inw.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0D8L8Q3_outward.pdb Alignment file: A0A0D8L8Q3_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed .8% week .8% disallowed Occluded: Model structure: A0A0D8L8Q3_occluded.pdb Alignment file: A0A0D8L8Q3_occ.pir Procheck score ⇒ Ramachandran plot: 96.0% favored 2.4% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA