Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0D6DXU9

dbSWEET id: dbswt_1362

Accession:   A0A0D6DXU9

Uniprot status:   Unreviewed

Organism:   Lactococcus piscium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Lactococcus.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A0D6DXU9|A0A0D6DXU9_9LACT|Unreviewed|Lactococcus piscium|86
MKNKVHLFIGSVGATIGLFVFLAYIPQIISNLNGDKSQPWQPLIAAISCLVWVLYGLTNQ
PKRDYILIIPNTLGVILGTLTFLTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0D6DXU9_inward.pdb    Alignment file: A0A0D6DXU9_inw.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    5.5% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0D6DXU9_outward.pdb    Alignment file: A0A0D6DXU9_out.pir

Procheck score ⇒ Ramachandran plot: 87.5% favored    7.8% allowed    3.1% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0D6DXU9_occluded.pdb    Alignment file: A0A0D6DXU9_occ.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    10.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur