| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0D3H8Q7
dbSWEET id: dbswt_64
Accession: A0A0D3H8Q7
Uniprot status: Unreviewed
Organism: Oryza barthii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 293
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0D3H8Q7|A0A0D3H8Q7_9ORYZ|Unreviewed|Oryza_barthii|293
MDHLWASVFGILGNIVSFLVFLAPMPTFLRVYRKKSTEGFSSVPYVVALFSCTLWILYAM
VKTNSSPLLTINAFGCVVEAAYIAVYLVYAPRPARLRALASFLLLNVAAFSLVVVVTVAA
VAQPHRVRVLGSICLAFSMAVFVAPMSVIMVVIKTKSAEFMPFSLSFFLTLSAVAWFFYG
LFTNDLYVTLPNVGGFFFGCVQMALYFKYRKPNTAAGGVMILPTTAAAAAVDGAVAEPAA
AAQQLAEELEMELAAAGAHAVAVLPASALPVLAELHKMEQEIGTPRKGATKTV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: A0A0D3H8Q7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0D3H8Q7_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0D3H8Q7_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0D3H8Q7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.8% allowed 1.1% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA