| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0D3FIF1
dbSWEET id: dbswt_314
Accession: A0A0D3FIF1
Uniprot status: Unreviewed
Organism: Oryza barthii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 302
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0D3FIF1|A0A0D3FIF1_9ORYZ|Unreviewed|Oryza_barthii|302
MVQALVFAVGIVGNILSFLVILAPVPTFYRVYKKKSTESFQSVPYAVALLSAMLWLYYAL
LTSDLLLLSINSIGCLVESLYLTVYLLYAPRQAMAFTLKLVCVMNLALFAAVVAALQLLV
KAADRRVTLAGGIGASFALAVFVAPLTIIRQVIRTKSVEFMPFWLSFFLTLSAVVWFFYG
LLMKDLFVATPNVLGLLFGLAQMVLYVVYKNPKKNSAVSEAAAAQQVEVKDQQQLQMQLQ
ASPAVAPLDVDADADADADLEAAAPATPQRPADDDAIDHRSVVVDIPPPPQPPPALPAVE
VA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: A0A0D3FIF1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0D3FIF1_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 4.2% allowed 1.0% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0D3FIF1_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 4.7% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0D3FIF1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0032588 - trans-Golgi network membrane
GO:0012506 - vesicle membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0071836 - nectar secretion
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA