Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0D3EFV0

dbSWEET id: dbswt_93

Accession:   A0A0D3EFV0

Uniprot status:   Unreviewed

Organism:   Brassica oleracea

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.

Sequence Information back to top


Sequence length:   298

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A0D3EFV0|A0A0D3EFV0_BRAOL|Unreviewed|Brassica_oleracea|298
MGVMINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW
LCYALIKQDAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMKLFLTINVAFFSLILM
VTHFAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAV
MWFAYGLFLQDICIAIPNVVGFILGMIQMVLYGIYRNSGEKLDTEKKMNPSEQQLKSVVV
MSPLSVSEVHPIDVCVTEPVDPFSDAVQHKDPSKVTKEKEPATDDGKCHVETARHESV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   217

Alignment file: A0A0D3EFV0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0D3EFV0_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.9% favored    4.1% allowed    .0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0D3EFV0_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.6% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0D3EFV0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.6% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   106314005     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur