| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0D2UJ29
dbSWEET id: dbswt_503
Accession: A0A0D2UJ29
Uniprot status: Unreviewed
Organism: Gossypium raimondii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.
Sequence Information back to top
Sequence length: 229
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>tr|A0A0D2UJ29|A0A0D2UJ29_GOSRA|Unreviewed|Gossypium_raimondii|229
MEELSFIVGVIGNVISVLVFLSPVGTFWRIVKNGSTEDFESLPYVCTLLSSSLWTYYGIT
KPGAYLVATVNGFGILAEAVYVVLFLIYAPRKMRVKTGILVGILNVGFLAAAILVTHLAL
EGDTRIDAIGFMCAGLNIIMYGSPLAAMKTVVTSKSVEYMPFFLSFFLFLNGGIWAFYAL
LEHDIFLGVPNGIGFLLGTAQLILYAIFRKARPSNDTISQGLLEQGFQK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A0D2UJ29.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0D2UJ29_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.4% favored 4.5% allowed .6% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0D2UJ29_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.4% favored 5.0% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0D2UJ29_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.3% allowed .0% week 1.1% disallowed
Gene Informationback to top
Gene ID: 105778466 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA