Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0D2SGM1

dbSWEET id: dbswt_251

Accession:   A0A0D2SGM1

Uniprot status:   Unreviewed

Organism:   Gossypium raimondii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.

Sequence Information back to top


Sequence length:   242

Substrate Binding Site:   SSWN           CVV:   405       CHI:   -6

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|A0A0D2SGM1|A0A0D2SGM1_GOSRA|Unreviewed|Gossypium_raimondii|242
MGFFGPHHQLAFIFGVLGSIVSFMVFLSPVKTFYTIYKKRTAEGYQSIPYMVALSSSMML
LYYGMLKTNANLIVGISCFGCAIEIIYLILYIVYAPKRDKVFTVKWIILFNLGGYCLIMV
ATNLFRERSKRVTVMGWVCAVNSVAVSASPLGIMRRVIRTKSVEYMPFLLSFFLTLCSTM
WFFYGLFLQDLYVAFPNVLGFLLGTAQMVIYVIYKNANKGVEKTEKMQKGDMEGSVGDIN
PS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   216

Alignment file: A0A0D2SGM1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0D2SGM1_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    3.2% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0D2SGM1_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0D2SGM1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    2.6% allowed    2.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur