Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0D2S234

dbSWEET id: dbswt_620

Accession:   A0A0D2S234

Uniprot status:   Unreviewed

Organism:   Gossypium raimondii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.

Sequence Information back to top


Sequence length:   233

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|A0A0D2S234|A0A0D2S234_GOSRA|Unreviewed|Gossypium_raimondii|233
MSSTVVSSVYVVCSDAAGIAGNIFAFVLFLSSIPTFRRIIRNESTEMVSGMPYIYALLNC
LICLWYGMPLVSPGIILVATVNSVGAIFQLIYISVFVVYAEKPMKLKMMGLLISVFATFA
SIVFVSMRFLDSPSRQLFVGYLSVASLISMFASPLIIIKLVIKTRSVEYMPFSLSLATFL
MSLAFFVYGMFKHDAFIYIPNGIGTGLGTLQLALYAYFNDASQEELKHPLIDP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   220

Alignment file: A0A0D2S234.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0D2S234_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.8% favored    3.7% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0D2S234_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    3.2% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0D2S234_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    5.3% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   105768788     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur