Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0D2QL38

dbSWEET id: dbswt_427

Accession:   A0A0D2QL38

Uniprot status:   Unreviewed

Organism:   Gossypium raimondii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.

Sequence Information back to top


Sequence length:   274

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A0D2QL38|A0A0D2QL38_GOSRA|Unreviewed|Gossypium_raimondii|274
MAHHHPWIFISGILGNILSFMVYLAPLPTFVRVYKKKSTEGFESLPYVVALVSAMLWIYY
ATLKPNAFLLMTINSIGCVVETIYIIVFIVYAPKKARILTLKLLLVFNMGALVLVLITHF
FSKGRSRIHVIGWSCVVTSAAVFAAPLSIMRSVIHTKSVEFMPFTLSFFLTCSAILWLVY
GLLLKDFYISLPNIVGVVLGTIQMLLYVVYKKFNNNIAKDHERKQPSPIVNGKNINHIKA
SNIHSSSPQVSGDIEVGRDENLYGPQLEHSDDGV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   212

Alignment file: A0A0D2QL38.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0D2QL38_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.8% favored    3.2% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0D2QL38_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    .5% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0D2QL38_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   105785857     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur