Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0D0LQZ7

dbSWEET id: dbswt_1360

Accession:   A0A0D0LQZ7

Uniprot status:   Unreviewed

Organism:   Flavobacterium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Flavobacterium.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0D0LQZ7|A0A0D0LQZ7_9FLAO|Unreviewed|Flavobacterium|87
MNLTDIIGLFAGICVTISVVPQIVKVWKTKKVKQISLLTFSVLTFGIAVWVVYGILKNDM
PIIITNSVSLFLNLIMVYFIIYYEKES

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0D0LQZ7_inward.pdb    Alignment file: A0A0D0LQZ7_inw.pir

Procheck score ⇒ Ramachandran plot: 95.7% favored    2.2% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0D0LQZ7_outward.pdb    Alignment file: A0A0D0LQZ7_out.pir

Procheck score ⇒ Ramachandran plot: 94.2% favored    5.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0D0LQZ7_occluded.pdb    Alignment file: A0A0D0LQZ7_occ.pir

Procheck score ⇒ Ramachandran plot: 100.0% favored    .0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur