Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0C9RNF1
dbSWEET id: dbswt_1027
Accession: A0A0C9RNF1
Uniprot status: Unreviewed
Organism: Fopius arisanus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Ichneumonoidea ⇒ Braconidae ⇒ Opiinae ⇒ Fopius.
Sequence Information back to top
Sequence length: 218
Substrate Binding Site: GNWN CVV: 403 CHI: -8.3
Selectivity Filter: QMLV CVV: 467 CHI: 6.4
Fasta sequence:
>tr|A0A0C9RNF1|A0A0C9RNF1_9HYME|Unreviewed|Fopius_arisanus|218
MGLEDYKEIVGNSAAICTMAQMLSGILICRDIHRKGTADGFDPMPFVGGIGMGLLMLQYA
FIVNDPAMISVNVFGLTTSILYVLVFYFYSPKKNELVMTIAKTLGIAGIFLAYAQIEEPV
TLEFRWGILTTALLFLLIAAPLANLGEVIRTKSTEILPFPLIAMGTLVSSQWLLYGIILD
NSFIIIQNVVGLGLYIIQLSLFAIFPSKPEAKLEKKAK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 207
Alignment file: A0A0C9RNF1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0C9RNF1_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 8.4% allowed 1.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0C9RNF1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.6% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0C9RNF1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 8.4% allowed .0% week .0% disallowed
Gene Informationback to top
Gene ID: 105268422 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5