Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0C9RNF1

dbSWEET id: dbswt_1027

Accession:   A0A0C9RNF1

Uniprot status:   Unreviewed

Organism:   Fopius arisanus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Ichneumonoidea ⇒ Braconidae ⇒ Opiinae ⇒ Fopius.

Sequence Information back to top


Sequence length:   218

Substrate Binding Site:   GNWN           CVV:   403       CHI:   -8.3

Selectivity Filter:   QMLV           CVV:   467       CHI:   6.4

Fasta sequence:

>tr|A0A0C9RNF1|A0A0C9RNF1_9HYME|Unreviewed|Fopius_arisanus|218
MGLEDYKEIVGNSAAICTMAQMLSGILICRDIHRKGTADGFDPMPFVGGIGMGLLMLQYA
FIVNDPAMISVNVFGLTTSILYVLVFYFYSPKKNELVMTIAKTLGIAGIFLAYAQIEEPV
TLEFRWGILTTALLFLLIAAPLANLGEVIRTKSTEILPFPLIAMGTLVSSQWLLYGIILD
NSFIIIQNVVGLGLYIIQLSLFAIFPSKPEAKLEKKAK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: A0A0C9RNF1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0C9RNF1_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.4% allowed    1.7% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0C9RNF1_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.6% allowed    .6% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0C9RNF1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    8.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   105268422     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur