Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0C9RK08

dbSWEET id: dbswt_578

Accession:   A0A0C9RK08

Uniprot status:   Unreviewed

Organism:   Wollemia nobilis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Pinidae ⇒ Araucariales ⇒ Araucariaceae ⇒ Wollemia.

Sequence Information back to top


Sequence length:   273

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNLT           CVV:   437       CHI:   3.4

Fasta sequence:

>tr|A0A0C9RK08|A0A0C9RK08_9SPER|Unreviewed|Wollemia_nobilis|273
MVNNLIRTGLGILGSGVSFMLYGGPIVTFWRIIKKRSTEDFSGVPYAIALFNCLIYTLYG
SPLVSDGWKNMTVMVVNSIGLVLECAFIGIFLTFAPPKIRVITARMVVGVLMVFATITGV
CFLAMHHKKHKQVLVGTAGMVATVVLYGAPLSVIRLVFKTKSAEFLPFNLSLCTFVTSIL
WLGYGALSKDIMIMAPNFLGLPLGSFQMVLHCMYKGNKGQTKDKKGNQGDLELGNNTFTE
EKRDKEKSDCPAEHDLEMQMQLNDVESDRASVK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   216

Alignment file: A0A0C9RK08.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0C9RK08_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0C9RK08_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.0% allowed    .0% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0C9RK08_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    6.5% allowed    2.2% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur