Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0C1Q3K4

dbSWEET id: dbswt_1357

Accession:   A0A0C1Q3K4

Uniprot status:   Unreviewed

Organism:   Pseudoalteromonas luteoviolacea

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Alteromonadales ⇒ Pseudoalteromonadaceae ⇒ Pseudoalteromonas.

Sequence Information back to top


Sequence length:   95

Substrate Binding Site:   FNFN           CVV:   462       CHI:   -1.4

Selectivity Filter:   AVAV           CVV:   344       CHI:   12

Fasta sequence:

>tr|A0A0C1Q3K4|A0A0C1Q3K4_9GAMM|Unreviewed|Pseudoalteromonas luteoviolacea|95
MLRATWTHFLMSDERYWDIAGVLFGGIGAFALLGQLLSEVNRDAESTLSMSFLFGYVVVF
MFWLLYGLRFKRPAIIWTNSVCLVLQSMIALVVLS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   18     Model end:   95

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0C1Q3K4_inward.pdb    Alignment file: A0A0C1Q3K4_inw.pir

Procheck score ⇒ Ramachandran plot: 88.1% favored    8.2% allowed    3.0% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0C1Q3K4_outward.pdb    Alignment file: A0A0C1Q3K4_out.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    3.0% allowed    .7% week    1.5% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0C1Q3K4_occluded.pdb    Alignment file: A0A0C1Q3K4_occ.pir

Procheck score ⇒ Ramachandran plot: 94.0% favored    6.0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur