Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0C1G1W0
dbSWEET id: dbswt_1356
Accession: A0A0C1G1W0
Uniprot status: Unreviewed
Organism: Leisingera
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhodobacterales ⇒ Rhodobacteraceae ⇒ Leisingera.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: CTCT CVV: 358 CHI: 3.6
Fasta sequence:
>tr|A0A0C1G1W0|A0A0C1G1W0_9RHOB|Unreviewed|Leisingera|88
MTATYIGFLAALLGTICWLPQAWKAWATRDTAGLSLPANLMFLGTVSLWLIYGLLVGDAP
IILANACSIVIVLAIIGAILKYKKGTDT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A0C1G1W0_inward.pdb Alignment file: A0A0C1G1W0_inw.pir Procheck score ⇒ Ramachandran plot: 96.9% favored 3.1% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0C1G1W0_outward.pdb Alignment file: A0A0C1G1W0_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 6.9% allowed .0% week .0% disallowed Occluded: Model structure: A0A0C1G1W0_occluded.pdb Alignment file: A0A0C1G1W0_occ.pir Procheck score ⇒ Ramachandran plot: 96.2% favored 3.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA