Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0B8TJJ5
dbSWEET id: dbswt_1351
Accession: A0A0B8TJJ5
Uniprot status: Unreviewed
Organism: Lactobacillus casei
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0B8TJJ5|A0A0B8TJJ5_LACCA|Unreviewed|Lactobacillus casei|94
MSKEELNRRLHQAKIVGNTATIACLIMYTSYIQQIISNFTGHPVSPLQPICASINALLWV
AYGWIKPKKDWRVIIANFPGIIFGILTFVTAYLH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 17 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: A0A0B8TJJ5_inward.pdb Alignment file: A0A0B8TJJ5_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 3.1% allowed 3.1% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0B8TJJ5_outward.pdb Alignment file: A0A0B8TJJ5_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 4.6% allowed 1.5% week .8% disallowed Occluded: Model structure: A0A0B8TJJ5_occluded.pdb Alignment file: A0A0B8TJJ5_occ.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA