Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B7ITU4

dbSWEET id: dbswt_1350

Accession:   A0A0B7ITU4

Uniprot status:   Unreviewed

Organism:   Capnocytophaga canis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.

Sequence Information back to top


Sequence length:   80

Substrate Binding Site:   CFCF           CVV:   442       CHI:   10.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0B7ITU4|A0A0B7ITU4_9FLAO|Unreviewed|Capnocytophaga canis|80
MSWYDFIGYAASLFVVGSFLIKDNIIYIRLTNLIGCVLFVIYGVLINNIPIILPNAFLML
VQIYFIFLKKKDKKKQSCDK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   73

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0B7ITU4_inward.pdb    Alignment file: A0A0B7ITU4_inw.pir

Procheck score ⇒ Ramachandran plot: 85.8% favored    10.8% allowed    3.3% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0B7ITU4_outward.pdb    Alignment file: A0A0B7ITU4_out.pir

Procheck score ⇒ Ramachandran plot: 83.3% favored    10.8% allowed    2.5% week    3.3% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0B7ITU4_occluded.pdb    Alignment file: A0A0B7ITU4_occ.pir

Procheck score ⇒ Ramachandran plot: 90.0% favored    5.0% allowed    3.3% week    1.7% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. IPR020137: Uncharacterised_HI1736. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur