Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B7IEC3

dbSWEET id: dbswt_1349

Accession:   A0A0B7IEC3

Uniprot status:   Unreviewed

Organism:   Capnocytophaga canimorsus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.

Sequence Information back to top


Sequence length:   83

Substrate Binding Site:   CFCF           CVV:   442       CHI:   10.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0B7IEC3|A0A0B7IEC3_9FLAO|Unreviewed|Capnocytophaga canimorsus|83
MNWIDFVGYTASFFVVLSFLIKQNVSRIRLVNLVGCVLFVIYGIYINSIPIIVPNAFLVF
VQLYYLLLHPKKDNSATNSENNI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   73

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0B7IEC3_inward.pdb    Alignment file: A0A0B7IEC3_inw.pir

Procheck score ⇒ Ramachandran plot: 87.5% favored    8.3% allowed    3.3% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0B7IEC3_outward.pdb    Alignment file: A0A0B7IEC3_out.pir

Procheck score ⇒ Ramachandran plot: 90.0% favored    9.2% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0B7IEC3_occluded.pdb    Alignment file: A0A0B7IEC3_occ.pir

Procheck score ⇒ Ramachandran plot: 86.7% favored    11.7% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. IPR020137: Uncharacterised_HI1736. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur