Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B7BES1

dbSWEET id: dbswt_1025

Accession:   A0A0B7BES1

Uniprot status:   Unreviewed

Organism:   Arion vulgaris

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Mollusca ⇒ Gastropoda ⇒ Heterobranchia ⇒ Euthyneura ⇒ Panpulmonata ⇒ Eupulmonata ⇒ Stylommatophora ⇒ Sigmurethra ⇒ Arionoidea ⇒ Arionidae ⇒ Arion.

Sequence Information back to top


Sequence length:   241

Substrate Binding Site:   CNMT           CVV:   399       CHI:   0.2

Selectivity Filter:   MVIN           CVV:   449       CHI:   7.1

Fasta sequence:

>tr|A0A0B7BES1|A0A0B7BES1_9EUPU|Unreviewed|Arion_vulgaris|241
MVMDFLPDLITIVEWATLILAFVMMASGLPICLNMYRNKSTANVPYLLFLVVEFVCNLGL
QYAIAVGNTTLIILNAVSAIVWGTYIGVYILVSKSKSKPLAMLFSVVGLFCAHIYYLTTV
PSNEYLPTIGKYMMVWCTSIGIIPAGEIYTIIQEKSTNCCNMSMMIGGTLNASVMCFYGY
LMNDIYISLPTVPGLLVNFIKIILIFRYGLPSGQSDINQISKDADDKVHNGKTGETLRRR
K

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   210

Alignment file: A0A0B7BES1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B7BES1_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.5% favored    8.7% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B7BES1_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.9% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B7BES1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.1% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur