| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0B7A730
dbSWEET id: dbswt_1024
Accession: A0A0B7A730
Uniprot status: Unreviewed
Organism: Arion vulgaris
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Mollusca ⇒ Gastropoda ⇒ Heterobranchia ⇒ Euthyneura ⇒ Panpulmonata ⇒ Eupulmonata ⇒ Stylommatophora ⇒ Sigmurethra ⇒ Arionoidea ⇒ Arionidae ⇒ Arion.
Sequence Information back to top
Sequence length: 242
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: MVLS CVV: 426 CHI: 9.1
Fasta sequence:
>tr|A0A0B7A730|A0A0B7A730_9EUPU|Unreviewed|Arion_vulgaris|242
MDFLPDLLTVVEWATVVVTFIMMASGMPVCVSMYKKRSVANVPYLLFLISTFVSSLGLQY
GILIGNSTLTLINVVSVCVWGAYVSTYILVSKSKVTPLLKLLAVAGLYSAHLYYLTILPS
NDVVLTVGKYLLFWCTILCVIPANEIVTMVQEKSTKCCNLPLLFGGTLSGVVWYLYGYLM
DDATIYFPNIPALLVSSVKFFLMFIYGLPSKQTAKNSSSAVTRDSQNNVHKVTATGITRR
NK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: A0A0B7A730.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0B7A730_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.2% favored 8.6% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0B7A730_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 8.1% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0B7A730_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.6% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA