Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B7A6J4

dbSWEET id: dbswt_1023

Accession:   A0A0B7A6J4

Uniprot status:   Unreviewed

Organism:   Arion vulgaris

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Mollusca ⇒ Gastropoda ⇒ Heterobranchia ⇒ Euthyneura ⇒ Panpulmonata ⇒ Eupulmonata ⇒ Stylommatophora ⇒ Sigmurethra ⇒ Arionoidea ⇒ Arionidae ⇒ Arion.

Sequence Information back to top


Sequence length:   246

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   MVLS           CVV:   426       CHI:   9.1

Fasta sequence:

>tr|A0A0B7A6J4|A0A0B7A6J4_9EUPU|Unreviewed|Arion_vulgaris|246
MDFLPDLLTVVEWATVVVTFIMMASGMPVCVSMYKKRSVANVPYLLFLISTFVSSLGLQY
GILIGNSTLTLINVVSVCVWGAYVSTYILVSKSKVTPLLKLLAVAGLYSAHLYYLTILPS
NDVVLTVGKYLLFWCTILCVIPANEIVTMVQEKSTKCCNLPLLFGGTLSGVVWYLYGYLM
DDATIYFPNIPALLVSSVKFFLMFIYGLPSKQTAKNSSSATTSAVTRDSQNNVHKVTATG
ITRRNK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: A0A0B7A6J4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B7A6J4_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.6% favored    7.6% allowed    2.7% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B7A6J4_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.6% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B7A6J4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.0% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur