Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B5HQ80

dbSWEET id: dbswt_2047

Accession:   A0A0B5HQ80

Uniprot status:   Unreviewed

Organism:   archaeon GW2011_AR10

Kingdom:   Archaea

Taxonomy back to top


Archaea.

Sequence Information back to top


Sequence length:   114

Substrate Binding Site:   AYAY           CVV:   416       CHI:   1

Selectivity Filter:   LLLL           CVV:   496       CHI:   15.2

Fasta sequence:

>tr|A0A0B5HQ80|A0A0B5HQ80_9ARCH|Unreviewed|archaeon GW2011_AR10|114
MPASGKGIHHFHIRKRVHENLEPYPHPEKWKRRMDKAIYAVGIAGPLLAIPQALEVWVEK
NVAGISLITWVGWLFLAFFWISYGVMHKEKPIIITYSAWVLINLFIIAGVIVYS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   35     Model end:   112

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0B5HQ80_inward.pdb    Alignment file: A0A0B5HQ80_inw.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.3% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0B5HQ80_outward.pdb    Alignment file: A0A0B5HQ80_out.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    3.8% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0B5HQ80_occluded.pdb    Alignment file: A0A0B5HQ80_occ.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.3% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur