Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B4DPF1

dbSWEET id: dbswt_1346

Accession:   A0A0B4DPF1

Uniprot status:   Unreviewed

Organism:   Leisingera

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhodobacterales ⇒ Rhodobacteraceae ⇒ Leisingera.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   CTCT           CVV:   358       CHI:   3.6

Fasta sequence:

>tr|A0A0B4DPF1|A0A0B4DPF1_9RHOB|Unreviewed|Leisingera|88
MNATYIGFLAALLGTICWLPQAWKAWATRDTAGLSLPANLMFLGTVSLWLIYGLLVGDAP
IILANACTIVIVLAIIAAILKYKKGTDT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0B4DPF1_inward.pdb    Alignment file: A0A0B4DPF1_inw.pir

Procheck score ⇒ Ramachandran plot: 98.5% favored    1.5% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0B4DPF1_outward.pdb    Alignment file: A0A0B4DPF1_out.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    4.5% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0B4DPF1_occluded.pdb    Alignment file: A0A0B4DPF1_occ.pir

Procheck score ⇒ Ramachandran plot: 97.7% favored    2.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur