Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B2VW50

dbSWEET id: dbswt_1022

Accession:   A0A0B2VW50

Uniprot status:   Unreviewed

Organism:   Toxocara canis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Ascaridida ⇒ Ascaridoidea ⇒ Toxocaridae ⇒ Toxocara.

Sequence Information back to top


Sequence length:   237

Substrate Binding Site:   SQAN           CVV:   350       CHI:   -6

Selectivity Filter:   LGGM           CVV:   344       CHI:   4.9

Fasta sequence:

>tr|A0A0B2VW50|A0A0B2VW50_TOXCA|Unreviewed|Toxocara_canis|237
MGTDIQDFVSHLFALYTANVAWSIFLTSTALHAILLITSPVQAVYKWYRRQSSDSDTPLP
YMCACVGSSLWLRYSMFIEDIKLILLQTYAVVMQVFFLTALIFYRSKKRRLMRALLSLVL
FLFALFIYVEALTHEDGKILIGRFASGSQIAGSLVCPYLIYRAFKTKVIDFIPFAPVAFT
WIMELHAIVYSIGINDFYMLLANTTFFLMDGSLLSMFLIYPTERKTRPTTTQHIHVL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   15     Model end:   222

Alignment file: A0A0B2VW50.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B2VW50_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.6% favored    6.2% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B2VW50_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    6.8% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B2VW50_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    7.8% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur