Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B2VJR7

dbSWEET id: dbswt_1021

Accession:   A0A0B2VJR7

Uniprot status:   Unreviewed

Organism:   Toxocara canis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Ascaridida ⇒ Ascaridoidea ⇒ Toxocaridae ⇒ Toxocara.

Sequence Information back to top


Sequence length:   223

Substrate Binding Site:   MNWN           CVV:   479       CHI:   -6

Selectivity Filter:   FMSL           CVV:   456       CHI:   7.7

Fasta sequence:

>tr|A0A0B2VJR7|A0A0B2VJR7_TOXCA|Unreviewed|Toxocara_canis|223
MVAWLSIFAAWLTAFSISFTFLPVFQVLDWKKRGTADGFSSVNLVLPCLMMGCWLRHGFM
TDDFTNMFINTTNLVIFTGYISAFAFYQPKRRYLIGQLIGLFFSLYLIFQYVDSQPEHLA
ADTMGTIAAAMQILSLGGQVYEIKRAVSFGHTEYIPAELQFGIFLLVTQWTVFGILIGNY
YIAVANFAALLVNIATLSMYFIYPPLTWRVPIFGVGPQEKKKE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   205

Alignment file: A0A0B2VJR7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B2VJR7_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.5% allowed    .0% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B2VJR7_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.5% allowed    2.2% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B2VJR7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.5% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur