| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0B2RD16
dbSWEET id: dbswt_402
Accession: A0A0B2RD16
Uniprot status: Unreviewed
Organism: Glycine soja
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.
Sequence Information back to top
Sequence length: 316
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: CSVS CVV: 337 CHI: 5.1
Fasta sequence:
>tr|A0A0B2RD16|A0A0B2RD16_GLYSO|Unreviewed|Glycine_soja|316
MSSHSHLSFAFGVLGNIASFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFY
AYVKTGEMLLITINAFGCVIETIYLAVFITYCPKKARMSTLRMIVLLNFGGFCTIVLLTH
LLAEGEGRVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSLLLLISAIMWLL
YGISLKDIYVTLPNVVGLTFGVIQIGLYAMYRNNKPVKDQKLPEHKGDIVDNNNESVIAP
TVNGEKQEQEVKPQGGIIETGEKKEENNKQDQQQPEENKKFDQVVHEQTKLNNKNTNNIN
DDDNNKTGERVISCEV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: A0A0B2RD16.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0B2RD16_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.2% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0B2RD16_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.3% allowed 2.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0B2RD16_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 5.3% allowed 1.6% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22