Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B2QQU2

dbSWEET id: dbswt_401

Accession:   A0A0B2QQU2

Uniprot status:   Unreviewed

Organism:   Glycine soja

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   309

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   CSVS           CVV:   337       CHI:   5.1

Fasta sequence:

>tr|A0A0B2QQU2|A0A0B2QQU2_GLYSO|Unreviewed|Glycine_soja|309
MSHSHLSFAFGILGNIASFVCFLAPLPTFYRVCKKKSTEGFQSIPYVAALFSAMLWIFYA
YVKTGETLLITINAFGCVIETIYLAVFITYCPKKARMSTLRMIVLLNFGGFCTIVLLTHL
LAKGEEARVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSLLLLISAIMWLL
YGISLKDIYVTLPNVVGLTFGVIQIGLYAMYRNNKPIKDQKLPEHKGDIVESENVIAPTV
NGEKQEQEVKPQGGDIEIGEKKEENNKQDQQQSVENKKLDQVAHDQTELNNNNINKNNNK
TEERVSCEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   213

Alignment file: A0A0B2QQU2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B2QQU2_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.8% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B2QQU2_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    5.3% allowed    .5% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B2QQU2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.5% favored    6.9% allowed    2.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur