Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B1SRA2

dbSWEET id: dbswt_1019

Accession:   A0A0B1SRA2

Uniprot status:   Unreviewed

Organism:   Oesophagostomum dentatum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Strongyloidea ⇒ Cloacinidae ⇒ Oesophagostomum.

Sequence Information back to top


Sequence length:   357

Substrate Binding Site:   GQWN           CVV:   400       CHI:   -5.5

Selectivity Filter:   LGDV           CVV:   368       CHI:   4.1

Fasta sequence:

>tr|A0A0B1SRA2|A0A0B1SRA2_OESDE|Unreviewed|Oesophagostomum_dentatum|357
MFEVFTHGISFLNLLSLAAFFTTVGLFFCGIPICRQIWKRKDTAEISGAPFLMGVLGGCC
WMTYGYLKNDQTVLVVTACQVVLYSTYTVFYWIMSRDKLWITIKVATVLSLCTALVLSVK
FFGMKVFHPLGIVCMTLNIGDFAAPLAGLRVVIRRGATSTLPLPLCIANFLVSSEWFLYG
LLVRDVYLITPNGIGSFLALCQLFLFVILPRKPGQRSLLSRICHCCAPSESEKETDLEAP
TKEIIPETPEEEDDEAGGHLTRARRWSKKVIAGMNSVAEEVEQLHVQEQNDEDSGSEKTE
DTVNGVPAKQLLAALQQQKGLVLNPENLDQKFACSLRLESGSMPKIRRTSSFPHLNK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: A0A0B1SRA2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B1SRA2_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.3% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B1SRA2_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.5% favored    5.0% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B1SRA2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.5% favored    7.7% allowed    2.2% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur