| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0B0PRA3
dbSWEET id: dbswt_796
Accession: A0A0B0PRA3
Uniprot status: Unreviewed
Organism: Gossypium arboreum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.
Sequence Information back to top
Sequence length: 255
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A0B0PRA3|A0A0B0PRA3_GOSAR|Unreviewed|Gossypium_arboreum|255
MVSHLVTTIRNVVGITGNVISLFLFLSPVPTFIRIWKKGSVEQFSPAPYLATLINCMVWV
VYGLPMVHPNSTLVVTINGTGTAIEIVYLTLFLIYCHDKKKRVKVMLIVLVEIIFIAGVT
ALVLIIAHTTQRRSMVVGIIAILFNIMMYAAPLSVMKLVITTKSVEYMPFFLSLASFANG
VAWTAYAFLPFDPFIAVPNGLGTLFSLAQLLLYATYYKSTKRIIAARQEAKMEMHLSEVV
VNGDNKDPKKNSTAP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 218
Alignment file: A0A0B0PRA3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0B0PRA3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.2% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0B0PRA3_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.8% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0B0PRA3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.8% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA