| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0B0PL21
dbSWEET id: dbswt_193
Accession: A0A0B0PL21
Uniprot status: Unreviewed
Organism: Gossypium arboreum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.
Sequence Information back to top
Sequence length: 278
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVG CVV: 331 CHI: 7.2
Fasta sequence:
>tr|A0A0B0PL21|A0A0B0PL21_GOSAR|Unreviewed|Gossypium_arboreum|278
MALHVSWAFVFGILGNVVSFLVSLAPLPTFYQIYKKRTSEGYQSIPYVVSLFSAMLWIYY
ALLKKDAMLLITINTFCVFIQTFYIVVYFYYGPKKEKLVTLKLILLFNVFGFGVIFFSTF
FLKNPLIRLQILGYICMGFALCVFVAPLGILRKVIKTKSVEYMPFTLSVFLTLGAVMWFF
YGLLLKDMNIAVPNVLGFIFGILQMILYAIYKNYPKKMVEDPKLQLSAQQVVVDVVKLGS
TTVSLEVNAVGPNPNNGDGTGEAQNIKTNNTADASNKV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: A0A0B0PL21.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0B0PL21_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 2.6% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0B0PL21_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.8% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0B0PL21_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 5.3% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22